Osint github tools. OSINT framework focused on gathering information from free tools or resources. Spyse - OSINT gathering platform that collects valuable data and stores it in its own database to provide info without scanning. This Python application is an OSINT (Open Source Intelligence) tool called "Ominis OSINT - Web Hunter. Para que la aplicación funcione correctamente The Instagram OSINT Tool gets a range of information from an Instagram account that you normally wouldn't be able to get from just looking at their profile. The information includes: ls: Display all Terra Commands help: For Help quit: For quiting the program clear: For cleaning your terminal screen exit: For exiting from Terra reset target : Reset new target in command line tweets : Get latest tweets tweeted by Target favtweets : Get latest tweets which favorited by Target followers : Get target's followers list following : Get target's following list info: Get overview A comprehensive list of tools that can be used for finding information related to a specific vehicle. team; QueryTool - Querytool is an OSINT framework based on Google Spreadsheets. To associate your repository with the osint-tool topic The tool is available in both Graphical User Interface (GUI) and Command-Line Interface (CLI) modes, ensuring a seamless user experience. Notifications You must be signed in to change notification settings Welcome to the OSINT (Open Source Intelligence) Resources repository, organized by country. Will help you get info on Protonmail accounts and users, ProtonVPN IP adresses, ProtonMail users' PGP Keys, Digital Footprints left by the ProtonMail user on the Clear and Dark Web This repository contains tools and links that can be used during OSINT in Pentest or Red Team. These tools cover The distinction between traditional social media and messenger apps is probably not as defined as it once was, "Social media are interactive technologies that facilitate the creation and sharing of information, ideas, interests, and other forms of expression through virtual communities and networks TikTok Open Source Intelligence Tool. Best osint tool for Termux and linux Dec 17, 2023 · usage: main. To associate your repository with the osint-tools topic More than 100 million people use GitHub to discover, fork, and contribute to over 420 million projects. There are free and paid tools you can use and owner is not responsible (take your own risks), only for knowledge or educational purposes. OSINT Toolbox, search leaked data for Email, Phone Number, Facebook account, Twitter profile and Telegram username. Database for OSINT targets; Integration / adaptation of many popular OSINT-tools (e. Contribute to Omicron166/TikTok-OSINT development by creating an account on GitHub. A curated list of OSINT tools for company research This Python application is an OSINT (Open Source Intelligence) tool called "Ominis OSINT - Web Hunter. Sin embargo, la versión de pago obtiene mejores resultados a través de algoritmos y cruce de datos que esta versión no realiza. Performs OSINT scan on a IP Address, Emails, Websites, Organizations and find out information from different sources. With an impressive accuracy rating of 87%, this tool has been designed to streamline your OSINT workflow. " It performs online information gathering by querying Google for search results related to a user-inputted query. Mosint is an automated email osint tool written in Go that allows you investigate for target emails in a fast and efficient manner. This repository has been archived. These tools will help you find sensitive public info before bad github: github. DaProfiler is an OSINT tool allowing you to collect More than 100 million people use GitHub to discover, fork, and contribute to over 420 million projects. WikiShootMe Worldwide map of geotagged Wikipedia Creative Commons Images. This motivated the creation of this list. Follow their code on GitHub. It relies on third-party services, such as the OpenAI API, various database engines, and other resources that may have associated costs. Collections of Tools, Bookmarks, and other guides created to aid in OSINT collection. Mar 8, 2023 · Here are some amazing GitHub OSINT tools: GitHub Search: You can use the built-in GitHub search feature to find repositories, users, and code snippets based on keywords or phrases. com View historical photos taken at a particular location on a map. Contribute to N0rz3/TraxOsint development by creating an account on GitHub. Octopii Octopii is a Personally Identifiable Information (PII) scanner. An OSINT tool to search fast for accounts by username across 131 sites. It was created with the aim of teaching the world how large Internet companies could obtain confidential information such as the status of sessions of their websites or services and control their users through their browser, without their knowledge, but It Darvester is meant to be the all-in-one solution for open-source intelligence on the Discord platform. Boto Detective Find information about people using phone numbers, names, email addresses, and social network IDs. To associate your repository with the osint-tool topic Open source intelligence (OSINT) is the practice of collecting information from published or otherwise publicly available sources. GitHub is where people build software. - rmehta24/OsintTool GoOSINT 130 Web-enabled OSINT and Cybersecurity Tools. The-Osint-Toolbox has 37 repositories available. - twintproject/twint OSINT Tools - OSINT Tools; OSINT tools for investigating websites-Shodan Cheat Sheet-Week in OSINT; Osint. OSINT Leaks Multi purpose OSINT search capability. The Slash OSINT Tool. Tool: Tool - DNSTwist: Identify bit-squatting, typo and other similar domains to the target using a local DNSTwist installation. Correlates and collaborate the results, show them in a consolidated manner. It consolidates numerous services, enabling security researchers to swiftly access a wealth of information. Tool: Tool - Nmap: Identify what Operating System might be used. This is an Open source intelligent framework ie an osint tool which gathers valid information about a phone number, user's email address, perform VIN Osint, and reverse, perform subdomain enumeration, able to find email from a name, and so much more. To display more More than 100 million people use GitHub to discover, fork, and contribute to over 420 million projects. The intention is to help people find free OSINT resources. With this tool you can perform complex search of terms, people, email addresses, files and many more. Datasploit - Tool to perform various OSINT techniques on usernames, emails addresses, and domains. Contribute to mxrch/GHunt development by creating an account on GitHub. Contribute to vil/H4X-Tools development by creating an account on GitHub. Alfred is a advanced OSINT information gathering tool that finds social media accounts based on inputs. Aug 15, 2023 · OSINT (open-source intelligence) is the practice of collecting information from published or otherwise publicly available sources. Currently, there are numerous awesome lists with tons of tools, but Offensive Security specialists often don't need such an extensive selection. El autor no se hace responsable del uso de esta aplicación. Blackbird is a robust OSINT tool that facilitates rapid searches for user accounts by username or email across a wide array of platforms, enhancing digital investigations. phoneinfoga) GitHub to email; Guide (Enter information you have and get web-tools recommended to help you) Account cards for each person in the database; Account discovery intigrating with the account cards; Pre defined commonly used fields in the database GitHub Copilot. A OSINT tool which helps you to quickly find information effectively. Trape is an OSINT analysis and research tool, which allows people to track and execute intelligent social engineering attacks in real time. Tool: Tool - Nuclei: Fast and customisable vulnerability scanner Roblox osint tool which finds information or data on a roblox account - phishontop/bloxsint This Python application is an OSINT (Open Source Intelligence) tool called "Ominis OSINT - Web Hunter. An OSINT / digital forensics tool built in Python. OSINT tools for Information gathering, Cybersecurity, Reverse searching, bugbounty, trust and safety, red team oprations and more. We’re a little fed up with OSINT tools claiming they’re the best. Contribute to 6abd/horus development by creating an account on GitHub. - HuyLe82US/alfred-osint More than 100 million people use GitHub to discover, fork, and contribute to over 420 million projects. After spending some time downloading & reviewing the top-rated OSINT tools according to Github by 1) the number of stars, 2) the number of pulls, 3) and the number of people currently contributing to the projects. It features WhatsMyName integration, export options in PDF, CSV, and HTTP response formats, and customizable search filters. Currently available in only Command Line Interface (CLI). Osintgram is a OSINT tool on Instagram to collect, analyze, and run reconnaissance. golang typescript osint web-interface information-gathering social-engineering osint-framework badgerdb open-source-intelligence github-osint email-osint osint-tool osint-tools osint-toolkit people-osint golang-osint go-osint-tool A curated list of OSINT tools for company research, internet scanning, DNS, and Whois lookups, organized for easy access. Ideal for analysts, researchers, and cybersecurity professionals. With the recent GEN2 releases, Darvester now provides an easy-to-use frontend UI along with new features such as multiple harvesting instances, or Isolates, for individual tokens, a refreshed Material 3 UI, and an all-in-one packaged app - no more Python dependencies and virtual environments! The Slash OSINT Tool. Apologies if some of the resources are no longer available or contain errors Protintelligence is a Python script for the Cyber Community. com: register osint twitter social-network email pypi emails ebay information-gathering trio tellonym open-source-intelligence osint-python osint-tools Osint tool for track ip adress . DNSservices - Discover embedded services in a domain's DNS records within seconds. Use specific script / launch automated OSINT for consolidated data. The Lockheed SR-71 "Blackbird" is a long-range, high-altitude, Mach 3+ strategic reconnaissance aircraft developed and manufactured by the American aerospace company Lockheed Corporation. All you need is to input and it will take take care of rest. It also uses NeutrOSINT made by Kr0wZ. Enterprise-grade AI features python linux cli osint tools sherlock python3 forensics cybersecurity infosec pentesting cti hacktoberfest golang typescript osint web-interface information-gathering social-engineering osint-framework badgerdb open-source-intelligence github-osint email-osint osint-tool osint-tools osint-toolkit people-osint golang-osint go-osint-tool An advanced Twitter scraping & OSINT tool written in Python that doesn't use Twitter's API, allowing you to scrape a user's followers, following, Tweets and more while evading most API limitations. OSINT operations, whether practiced by IT security pros, malicious hackers, or state-sanctioned intelligence operatives, use advanced techniques to search through the vast haystack of visible data to find the needles they're looking for to achieve their goals—and GHunt - GHunt is an OSINT tool to extract a lot of informations of someone's Google Account email. Contains a list of OSINT tools, OSINT tips, datasets, Maltego transform and others. Warning: It is advisable to not use your own/primary account when using this tool. Tool: Tool - nbtscan: Scans for open NETBIOS nameservers on your target's network. JDownloader JDownloader is a free, open-source download management tool. Pastvu. Greasy Fork Scripts to help you with your OSINT. Feel free to add to your own investigative toolkit, however you may NOT sell or host this without obtaining prior permission. 🕵️♂️ Offensive Google framework. A collection of a wide variety of online tools for #osint and not only: search for users with a specific name on different sites, one domain #Google Image search, YouTube tags viewer, url-extractor and much more Jul 31, 2022 · Check out the top 10 most rated OSINT tools according to Github stats. py [-h] [-u USERNAME] [-s] [-l [OPTIONS]] [-m] [-d [OPTIONS]] [-o DIRECTORY] [-t TIMEOUT] SnapIntel OSINT Tool - Made by KrowZ optional arguments: -h, --help show this help message and exit -u USERNAME, --username USERNAME Username of account we want to download stories from -s, --stats Only prints summary and statistics about the account -l [OPTIONS], --list [OPTIONS] List the Coeus 🌐 is an OSINT ToolBox empowering users with tools for effective intelligence gathering from open sources. support - Open Source Intelligence (OSINT) is the collection and analysis of information that is gathered from public, or open, sources. BirdHunt A very simple tool that allows you to select a geolocation/radius and get a list of recent tweets made in that place. Disclaimer: FOR EDUCATIONAL PURPOSE ONLY! The contributors do not assume any responsibility for the use of this tool. Discoshell - A simple discovery script that uses popular tools like subfinder, amass, puredns, alterx, massdns and others. So, we spent some time looking at some hard facts from Github. Esta aplicación es la versión open source con licencia GNU. MetaOSINT - A tool to quickly identify relevant, publicly-available open source intelligence ("OSINT") tools and resources, saving valuable time during investigations, research, and analysis. Some of the sites included might require registration or offer more data for $$$, but you should be able to get at least a portion of the available information for no cost. - GitHub - TheBurnsy/Vehicle-OSINT-Collection: A comprehensive list of tools that can be used for finding information related to a specific vehicle. Contribute to theahmadov/slash development by creating an account on GitHub. From social media monitoring 📱 to data analysis 📊, it offers a centralized platform for seamless OSINT investigations. More than 100 million people use GitHub to discover, fork, and contribute to over 420 million projects. g. Open source toolkit for scraping, OSINT and more. MetaOSINT enables open source intelligence ("OSINT") practitioners to jumpstart their investigations by quickly identifying relevant, publicly-available tools and resources, saving valuable time during investigations, research, and analysis. See what we find out, and how you can use them for investigations. - neospl0it/osint-bookmark A set of social media OSINT tools that I use when participating in Trace Labs Search Party CTF - LinaYorda/OSINTtools. You can The-OSINT-Toolbox by cqcore. Feel free to The osintgpt tool is provided for research purposes and intended to assist users in analyzing data from open-source intelligence (OSINT) tools more efficiently. Here you'll find a collection of links to various OSINT tools, websites, and projects that are specific to different countries. Osint. Maltego OSINT Tool. The tool extracts relevant information such as titles, URLs, and potential mentions of the query in the results. sakznpdshlvoddalgkfffmvaivtdcsrpiktfyrmiahksbkiohj